PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g04250.1
Common NameLR48_Vigan04g236500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 202aa    MW: 22356.3 Da    PI: 10.1782
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g04250.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-1496140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++ ++ + ++lG+g+W+ I++ + k+Rt+ q+ s+ qky
   Vang05g04250.1  96 AWTEEEHKVFLLGLQKLGKGNWRGISKSFVKTRTPVQVASHAQKY 140
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.763522IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.20789145IPR017930Myb domain
SuperFamilySSF466892.3E-1791145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1792144IPR006447Myb domain, plants
SMARTSM007171.0E-993143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1193139IPR009057Homeodomain-like
PfamPF002495.7E-1296140IPR001005SANT/Myb domain
CDDcd001679.18E-1096141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGIARKCSYC GKLGHNSRTC KSPLGHGDLK LFGVQLDISS SSSSTISFSS PSYSALTNHF  60
FSSSPSFRDE NQNSDAFLLT ANTLLSRIQD TKKGVAWTEE EHKVFLLGLQ KLGKGNWRGI  120
SKSFVKTRTP VQVASHAQKY FLRQSHNTFH KTKHSRTLFH VPSSSTSTSS SSNCTAQMPH  180
PDLELKLATP MPLELYQMHE F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499363.11e-109PREDICTED: myb-like protein J
TrEMBLA0A0L9UHY11e-148A0A0L9UHY1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RBN61e-148A0A0S3RBN6_PHAAN; Uncharacterized protein
STRINGGLYMA06G05450.29e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151421013
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-37MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]